Mouse Anti-BAP1 Antibody (CBMOAB-25063FYC)


Cat: CBMOAB-25063FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25063FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO25063FC 100 µg
CBMOAB-36773FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36773FYA 100 µg
CBMOAB-67433FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67433FYA 100 µg
MO-AB-00152L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00152L 100 µg
MO-AB-00262Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00262Y 100 µg
MO-AB-06330Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06330Y 100 µg
MO-AB-07326Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07326Y 100 µg
MO-AB-07965R Monoclonal Cattle (Bos taurus) WB, ELISA MO07965R 100 µg
MO-AB-14347Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14347Y 100 µg
MO-AB-20876W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20876W 100 µg
MO-AB-24072R Monoclonal Pig (Sus scrofa) WB, ELISA MO24072R 100 µg
MO-AB-29213W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29213W 100 µg
MO-AB-32876H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32876C 100 µg
MO-AB-41309W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41309W 100 µg
MO-AB-43838W Monoclonal Horse (Equus caballus) WB, ELISA MO43838W 100 µg
MO-AB-51743W Monoclonal Marmoset WB, ELISA MO51743W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO25063FC
SpecificityThis antibody binds to Arabidopsis BAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the ubiquitin C-terminal hydrolase subfamily of deubiquitinating enzymes that are involved in the removal of ubiquitin from proteins. The encoded enzyme binds to the breast cancer type 1 susceptibility protein (BRCA1) via the RING finger domain of the latter and acts as a tumor suppressor. In addition, the enzyme may be involved in regulation of transcription, regulation of cell cycle and growth, response to DNA damage and chromatin dynamics. Germline mutations in this gene may be associated with tumor predisposition syndrome (TPDS), which involves increased risk of cancers including malignant mesothelioma, uveal melanoma and cutaneous melanoma.
Product OverviewMouse Anti-Arabidopsis BAP1 Antibody is a mouse antibody against BAP1. It can be used for BAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBRCA1 Associated Protein 1; BRCA1 Associated Protein-1 (Ubiquitin Carboxy-Terminal Hydrolase); Cerebral Protein 6; Ubiquitin Carboxyl-Terminal Hydrolase BAP1; Ubiquitin Carboxy-Terminal Hydrolase; BRCA1-Associated Protein 1; Cerebral Protein-13
UniProt IDQ941L2
Protein RefseqThe length of the protein is 192 amino acids long. The sequence is show below: MIYFGRSIDNHYTTMMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESRRSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQRQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry