Mouse Anti-Barrel medic PIN4 Antibody (MO-AB-00485W)


Cat: MO-AB-00485W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula)
CloneMO00485W
SpecificityThis antibody binds to Barrel medic PIN4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
Product OverviewMouse Anti-Barrel medic PIN4 Antibody is a mouse antibody against PIN4. It can be used for PIN4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAuxin efflux carrier family transporter; Auxin efflux carrier protein; PIN4; MTR_6g069510
UniProt IDQ8GV74
Protein RefseqThe length of the protein is 604 amino acids long.
The sequence is show below: MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIASNNPYKMNLRFLAADTLQKLIILCLLAIWSNFSKRGCLEWTITLFSLSTLPNTLVMGIPLLKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFPDTAGSIVSIHVDSDVMSLDGRTPLETDAEIKEDGKLHITVRKSNASRSDIYSRRSQGLSSNTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHTDFYSMMGGGNGRNSNFGANDVVNNYGLSANSRGVTPRPSNYEEEANNNAKKFKNYPAPNPGMFSPTNNNNGSKNLGSNVSVNAKKSNGQSQQKQEDLHMFVWSSSASPVSDVFGGHDFGAHDQKEVKLNVSPGKVEGHRETQEDYLEKDEFSFGNKGMEREMNQHEGGEKGGDGKSKVMPPASVMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFRYHIEMPAIIAKSISILSDAGLGMAMFSLGLFMALQPKIIACGNSIAAFSMGVRFLVGPAVMAAASFAVGLKGVLFHVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILMGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry