AibGenesis™ Mouse Anti-RR1 Antibody (MO-AB-00573W)


Cat: MO-AB-00573W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00573W Monoclonal Barrel medic (Medicago truncatula), French-bean, Shrimp white spot syndrome virus WB, ELISA MO00573W 100 µg
MO-AB-30175H Monoclonal Shrimp white spot syndrome virus WB, ELISA MO30175C 100 µg
MO-AB-36602W Monoclonal French-bean WB, ELISA MO36602W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), French-bean, Shrimp white spot syndrome virus
CloneMO00573W
SpecificityThis antibody binds to Barrel medic RR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic RR1 Antibody is a mouse antibody against RR1. It can be used for RR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesResponse regulator 1; Two-component response regulator; Two-component response regulator ARR1; RR1; MTR_3g102600
UniProt IDG7ZXM3
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MDDFSDRFPIGMRVLAVDDDPTSLLLLETLLRSCQYHVTTTSEAITALTMLQENIDMFDLVIAEVHMPDMDGLKLLELVGLEMDLPVIMLSAHGETELVMKAISHGARDFLLKPVRLEELRNIWQHVIRNKESQFVWSVELHRKFLETVNQLGVDKAVPKKIFDLMNVENITREDVATHLQKYRLFLKRMDSSGHFHNNTIRSFSPAGIVGNLNTPAGLNGQFGHNSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry