Mouse Anti-BATF3 Antibody (CBMOAB-36782FYA)
Cat: CBMOAB-36782FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36782FYA | Monoclonal | Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO36782FYA | 100 µg | ||
| CBMOAB-67452FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67452FYA | 100 µg | ||
| MO-AB-24324H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24324C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO36782FYA |
| Specificity | This antibody binds to Rhesus BATF3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription. |
| Product Overview | Mouse Anti-Rhesus BATF3 Antibody is a mouse antibody against BATF3. It can be used for BATF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Basic leucine zipper transcriptional factor ATF-like 3; BATF3 |
| UniProt ID | H9FGV3 |
| Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: PEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYECLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry