Mouse Anti-BATF3 Antibody (CBMOAB-36782FYA)


Cat: CBMOAB-36782FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36782FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36782FYA 100 µg
CBMOAB-67452FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67452FYA 100 µg
MO-AB-24324H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24324C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36782FYA
SpecificityThis antibody binds to Rhesus BATF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription. (From NCBI)
Product OverviewMouse Anti-Rhesus BATF3 Antibody is a mouse antibody against BATF3. It can be used for BATF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBasic leucine zipper transcriptional factor ATF-like 3; BATF3
UniProt IDH9FGV3
Protein RefseqThe length of the protein is 75 amino acids long.
The sequence is show below: PEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYECLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry