Mouse Anti-BCL3 Antibody (MO-AB-24109R)


Cat: MO-AB-24109R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24109R Monoclonal Pig (Sus scrofa), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO24109R 100 µg
CBMOAB-36873FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36873FYA 100 µg
CBMOAB-67575FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67575FYA 100 µg
MO-AB-21775W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21775W 100 µg
MO-AB-51813W Monoclonal Marmoset WB, ELISA MO51813W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO24109R
SpecificityThis antibody binds to Pig BCL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B. (From NCBI)
Product OverviewThis product is a mouse antibody against BCL3. It can be used for BCL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB-cell chronic lymphatic leukemia protein 3; BCL3
UniProt IDG9M4N0
Protein RefseqThe length of the protein is 454 amino acids long.
The sequence is show below: MPRCPAGTMDEGPVDLRTRPKAGGPPGAALPLRKRPLRPPSPEPAAPRGAAGPAVPSDPLRGGSDAPAVPAPPHGLARPEAVYYPGPLLPLYPTPTMGSPFPLLNLPTPLYPMVCSMEHPLSADIAVATRADEDGDTPLHIAVVQGNLPAVHRLVSLFHHGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVMAGASPMALDRHGQTAAHLACEHRSPACLRALLDSAAGGTMDLEARNYDGLTALHVAVNTECHKAVLLLLEHGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKATRPAPASQPEPSPDRSATTSPESGSRLSSNGLLSASPPSSPSQSPPKDTPGFSMAPPSFFLPPSSPPTFLPFARVLRAPGRPVPPSPAPGGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry