AibGenesis™ Mouse Anti-BCL7A Antibody (CBMOAB-36874FYA)


Cat: CBMOAB-36874FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36874FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36874FYA 100 µg
CBMOAB-67580FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67580FYA 100 µg
MO-AB-01281W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01281W 100 µg
MO-AB-23859W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23859W 100 µg
MO-AB-51818W Monoclonal Marmoset WB, ELISA MO51818W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO36874FYA
SpecificityThis antibody binds to Rhesus BCL7A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BCL7A Antibody is a mouse antibody against BCL7A. It can be used for BCL7A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL7A
UniProt IDF7E7W3
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: EKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKADEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAESSAISQVPRSRSQRGSQIGREPIGLLGDLEGVPPSKKMKLEASQQNSEEM.
For Research Use Only | Not For Clinical Use.
Online Inquiry