Mouse Anti-BCO2 Antibody (CBMOAB-36887FYA)


Cat: CBMOAB-36887FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36887FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Sheep (Ovis aries) WB, ELISA MO36887FYA 100 µg
MO-AB-01832H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01832C 100 µg
MO-AB-14363Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14363Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Sheep (Ovis aries)
CloneMO36887FYA
SpecificityThis antibody binds to Rhesus BCO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme which oxidizes carotenoids such as beta-carotene during the biosynthesis of vitamin A. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus BCO2 Antibody is a mouse antibody against BCO2. It can be used for BCO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCO2
UniProt IDF6VNP2
Protein RefseqThe length of the protein is 550 amino acids long.
The sequence is show below: VFKRYMGNAHQKKAIFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVMSEFGTLAIPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSFGPFGFSYKVIRVPPEKVDLEETIHGAQVICSIAPTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVDKHTGQLLPGRYYSKPFVAFHHINAFEDQGCVIIDLCCQDNGRILEVYQLQNLRKAGEELDQVYNSAGRSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYGQFSGKKYRFFYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPVPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI.
See other products for " BCO2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry