Mouse Anti-BD1 Antibody (MO-AB-34164W)


Cat: MO-AB-34164W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-34164W Monoclonal Donkey (Equus asinus), Maize (Zea mays) WB, ELISA MO34164W 100 µg
MO-AB-47481W Monoclonal Maize (Zea mays) WB, ELISA MO47481W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDonkey (Equus asinus), Maize (Zea mays)
CloneMO34164W
SpecificityThis antibody binds to Donkey BD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Donkey BD1 Antibody is a mouse antibody against BD1. It can be used for BD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-defensin 1; BD1
UniProt IDA9YPC5
Protein RefseqThe length of the protein is 64 amino acids long.
The sequence is show below: MKILHFLLAFLVVFLLPVPGFTAGTGNSVTCSKNGGFCISPKCPPGMKQIGTCGLPGSKCCRKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry