AibGenesis™ Mouse Anti-BEND6 Antibody (CBMOAB-36922FYA)


Cat: CBMOAB-36922FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36922FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO36922FYA 100 µg
MO-AB-22165W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22165W 100 µg
MO-AB-51846W Monoclonal Marmoset WB, ELISA MO51846W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO36922FYA
SpecificityThis antibody binds to Rhesus BEND6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a corepressor of recombining binding protein suppressor hairless (RBPJ) and inhibits Notch signaling in neural stem cells, thereby opposing their self-renewal and promoting neurogenesis (PubMed:23571214). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus BEND6 Antibody is a mouse antibody against BEND6. It can be used for BEND6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBEND6
UniProt IDF6R348
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: LVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSSPDSFASTCSNSNSSSPDSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKAVKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTKKPNVSKNLNSQDIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry