Mouse Anti-Best3 Antibody (CBMOAB-02378FYA)


Cat: CBMOAB-02378FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02378FYA Monoclonal Fruit fly (Drosophila melanogaster), C. elegans (Caenorhabditis elegans), Rhesus (Macaca mulatta) WB, ELISA MO02378FYA 100 µg
CBMOAB-36928FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36928FYA 100 µg
CBMOAB-00925HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00925HB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), C. elegans (Caenorhabditis elegans), Rhesus (Macaca mulatta)
CloneMO02378FYA
SpecificityThis antibody binds to fruit fly Best3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length (Stohr et al., 2002 [PubMed 12032738]; Tsunenari et al., 2003 [PubMed 12907679]).
Product OverviewMouse Anti-D. melanogaster Best3 Antibody is a mouse antibody against Best3. It can be used for Best3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBestrophin 3; IP03329p; IP03529p; Best3
UniProt IDQ9VUM7
Protein RefseqThe length of the protein is 535 amino acids long.
The sequence is show below: MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVIYRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYITVPWPDPLAVYVSALVRGQDEHGRLMRRTIMRYVCLALTMVLSMISPVIKRRFPTYDQLIEVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRARKEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYSYFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLICPFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVRDQYWDEVFPAELPYAVESDRAEHPEASTARLGIPKVVPVTMTKSEVSLENDFTEFDDEDEYNPEVTIRFARREFSWSKSSVSVSYSYDNQSIDTLDEKVDEENEGDTRTLDSRNKDDFDRLKEKRDRERVNRQMQQAALAMELIKGDLASNGGSARSSRTNVPQKNSDVQTDRSYLSQKKRKEEDTDNDKDSDESKK.
See other products for " BEST3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry