Mouse Anti-BEX2 Antibody (CBMOAB-36950FYA)


Cat: CBMOAB-36950FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36950FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO36950FYA 100 µg
MO-AB-01291W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01291W 100 µg
MO-AB-08061R Monoclonal Cattle (Bos taurus) WB, ELISA MO08061R 100 µg
MO-AB-24367H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24367C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO36950FYA
SpecificityThis antibody binds to Rhesus BEX2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the brain expressed X-linked gene family. The encoded protein interacts with the transcription factor LIM domain only 2 in a DNA-binding complex that recognizes the E-box element and promotes transcription. This gene has been found to be a tumor suppressor that is silenced in human glioma. In breast cancer cells, this gene product modulates apoptosis in response to estrogen and tamoxifen, and enhances the anti-proliferative effect of tamoxifen. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus BEX2 Antibody is a mouse antibody against BEX2. It can be used for BEX2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBEX2
UniProt IDF6XD12
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MQKMVVCEAKCRGDAPHVENREEEETARIGPGVMESKEERALNNLNVENVNQENDEKDEKEQVANKGEPLALPLNVDEYCVPRGNRRRFRVRQPTLQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP.
For Research Use Only | Not For Clinical Use.
Online Inquiry