Mouse Anti-BFAR Antibody (CBMOAB-36951FYA)


Cat: CBMOAB-36951FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36951FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO36951FYA 100 µg
MO-AB-01847H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01847C 100 µg
MO-AB-08064R Monoclonal Cattle (Bos taurus) WB, ELISA MO08064R 100 µg
MO-AB-15901W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15901W 100 µg
MO-AB-51857W Monoclonal Marmoset WB, ELISA MO51857W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO36951FYA
SpecificityThis antibody binds to Rhesus BFAR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BFAR Antibody is a mouse antibody against BFAR. It can be used for BFAR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBFAR
UniProt IDF6SEI5
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MEEPQKNYLNTMDLEKDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVNILLRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGMKPPQNLWEYKAVNPGRSLFLLYALKSSPRLGLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry