AibGenesis™ Mouse Anti-BGLAP Antibody (MO-AB-07341Y)


Cat: MO-AB-07341Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07341Y Monoclonal Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine, Marmoset, Pig, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO07341Y 100 µg
CBMOAB-67643FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67643FYA 100 µg
MO-AB-09730W Monoclonal Cat (Felis catus) WB, ELISA MO09730W 100 µg
MO-AB-29242W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29242W 100 µg
MO-AB-36770W Monoclonal Goat (Capra hircus) WB, ELISA MO36770W 100 µg
MO-AB-43853W Monoclonal Horse (Equus caballus) WB, ELISA MO43853W 100 µg
MO-AB-51858W Monoclonal Marmoset WB, ELISA MO51858W 100 µg
MO-AB-08071R Monoclonal Cattle (Bos taurus) WB, ELISA MO08071R 100 µg
MO-AB-24371H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24371C 100 µg
MOFAB-124W Monoclonal Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine WB, ELISA, IHC WOC4 100 µg
MOFY-0622-FY60 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY269 Polyclonal Pig WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine, Marmoset, Pig, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO07341Y
SpecificityThis antibody binds to Rabbit BGLAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015] (From NCBI)
Product OverviewThis product is a mouse antibody against BGLAP. It can be used for BGLAP detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesOsteocalcin; BGLAP
UniProt IDG1TTE8
Protein RefseqThe length of the protein is 100 amino acids long. The sequence is show below: MRALTLVALLALAALCLAGQAEAKPSGAESGRGSAFVSKREGSEVVKRARRQLIDGQGAPAPYPDPLEPKREVCELNPDCDELADQVGLQDAYQRFYGPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry