Mouse Anti-BGLAP Antibody (MO-AB-07341Y)
Cat: MO-AB-07341Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-07341Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine, Marmoset, Pig, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO07341Y | 100 µg | ||
| CBMOAB-67643FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67643FYA | 100 µg | ||
| MO-AB-09730W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09730W | 100 µg | ||
| MO-AB-29242W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29242W | 100 µg | ||
| MO-AB-36770W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36770W | 100 µg | ||
| MO-AB-43853W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43853W | 100 µg | ||
| MO-AB-51858W | Monoclonal | Marmoset | WB, ELISA | MO51858W | 100 µg | ||
| MO-AB-08071R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08071R | 100 µg | ||
| MO-AB-24371H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24371C | 100 µg | ||
| MOFAB-124W | Monoclonal | Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine | WB, ELISA, IHC | WOC4 | 100 µg | ||
| MOFY-0622-FY60 | Polyclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY269 | Polyclonal | Pig | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Goat (Capra hircus), Horse (Equus caballus), Human, Rat, Rabbit, Sheep, Goat, Chicken, Canine, Porcine, Marmoset, Pig, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO07341Y |
| Specificity | This antibody binds to Rabbit BGLAP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015] |
| Product Overview | This product is a mouse antibody against BGLAP. It can be used for BGLAP detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Osteocalcin; BGLAP |
| UniProt ID | G1TTE8 |
| Protein Refseq | The length of the protein is 100 amino acids long. The sequence is show below: MRALTLVALLALAALCLAGQAEAKPSGAESGRGSAFVSKREGSEVVKRARRQLIDGQGAPAPYPDPLEPKREVCELNPDCDELADQVGLQDAYQRFYGPV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry