Mouse Anti-BHLHE41 Antibody (CBMOAB-36962FYA)


Cat: CBMOAB-36962FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36962FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36962FYA 100 µg
CBMOAB-67664FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67664FYA 100 µg
MO-AB-08075R Monoclonal Cattle (Bos taurus) WB, ELISA MO08075R 100 µg
MO-AB-51862W Monoclonal Marmoset WB, ELISA MO51862W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO36962FYA
SpecificityThis antibody binds to Rhesus BHLHE41.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. Defects in this gene are associated with the short sleep phenotype.
Product OverviewMouse Anti-Rhesus BHLHE41 Antibody is a mouse antibody against BHLHE41. It can be used for BHLHE41 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBHLHE41
UniProt IDF7ADI4
Protein RefseqThe length of the protein is 207 amino acids long.
The sequence is show below: MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHVHAVATLFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERA.
For Research Use Only | Not For Clinical Use.
Online Inquiry