AibGenesis™ Mouse Anti-Bin1 Antibody (CBMOAB-02521FYA)


Cat: CBMOAB-02521FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02521FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO02521FYA 100 µg
CBMOAB-36978FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36978FYA 100 µg
MO-AB-01302W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01302W 100 µg
MO-AB-01858H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01858C 100 µg
MO-AB-08085R Monoclonal Cattle (Bos taurus) WB, ELISA MO08085R 100 µg
MO-AB-11741W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11741W 100 µg
MO-AB-51868W Monoclonal Marmoset WB, ELISA MO51868W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO02521FYA
SpecificityThis antibody binds to fruit fly Bin1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in several transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Bin1 Antibody is a mouse antibody against Bin1. It can be used for Bin1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase complex subunit SAP18; 18 kDa Sin3-associated polypeptide; Bicoid-interacting protein 1; dSAP18; Bin1; SAP18
UniProt IDQ9VEX9
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry