Mouse Anti-Bin1 Antibody (CBMOAB-02521FYA)
Cat: CBMOAB-02521FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02521FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO02521FYA | 100 µg | ||
| CBMOAB-36978FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36978FYA | 100 µg | ||
| MO-AB-01302W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01302W | 100 µg | ||
| MO-AB-01858H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01858C | 100 µg | ||
| MO-AB-08085R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08085R | 100 µg | ||
| MO-AB-11741W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11741W | 100 µg | ||
| MO-AB-51868W | Monoclonal | Marmoset | WB, ELISA | MO51868W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO02521FYA |
| Specificity | This antibody binds to fruit fly Bin1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in several transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. |
| Product Overview | Mouse Anti-D. melanogaster Bin1 Antibody is a mouse antibody against Bin1. It can be used for Bin1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Histone deacetylase complex subunit SAP18; 18 kDa Sin3-associated polypeptide; Bicoid-interacting protein 1; dSAP18; Bin1; SAP18 |
| UniProt ID | Q9VEX9 |
| Protein Refseq | The length of the protein is 150 amino acids long. The sequence is show below: MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry