Mouse Anti-BIN2 Antibody (MO-AB-08086R)


Cat: MO-AB-08086R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08086R Monoclonal Cattle (Bos taurus), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08086R 100 µg
CBMOAB-36979FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36979FYA 100 µg
MO-AB-51874W Monoclonal Marmoset WB, ELISA MO51874W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Rhesus (Macaca mulatta)
CloneMO08086R
SpecificityThis antibody binds to Cattle BIN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle BIN2 Antibody is a mouse antibody against BIN2. It can be used for BIN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBIN2 protein; BIN2
UniProt IDA4FUG5
Protein RefseqThe length of the protein is 519 amino acids long.
The sequence is show below: MAEGRAGGAAGLFAKQVQKKFSRAQEKVLQKLGKTVETKDERFEQSASNFHQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSKWDGHEELKAIVANNDLLWEDYEEKLADQVLRTMENYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQLVFEDLNQELLEELPVLYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSDKVFVVKGLSSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry