Mouse Anti-BIRC5 Antibody (CBMOAB-36985FYA)
Cat: CBMOAB-36985FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36985FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO36985FYA | 100 µg | ||
MO-AB-00650Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00650Y | 100 µg | ||
MO-AB-08089R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08089R | 100 µg | ||
MO-AB-08420W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08420W | 100 µg | ||
MO-AB-17436W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17436W | 100 µg | ||
MO-AB-24379H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24379C | 100 µg | ||
MO-AB-29250W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29250W | 100 µg | ||
MO-AB-41316W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41316W | 100 µg | ||
MO-AB-51879W | Monoclonal | Marmoset | WB, ELISA | MO51879W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) |
Clone | MO36985FYA |
Specificity | This antibody binds to Rhesus BIRC5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus BIRC5 Antibody is a mouse antibody against BIRC5. It can be used for BIRC5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BIRC5 |
UniProt ID | F6Q7Y0 |
Protein Refseq | The length of the protein is 165 amino acids long. The sequence is show below: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIRPYYSYNWLSFWTLGGHVFIITQEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRCAIEQLAATD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry