Mouse Anti-BIRC5 Antibody (CBMOAB-36985FYA)


Cat: CBMOAB-36985FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36985FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO36985FYA 100 µg
MO-AB-00650Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00650Y 100 µg
MO-AB-08089R Monoclonal Cattle (Bos taurus) WB, ELISA MO08089R 100 µg
MO-AB-08420W Monoclonal Cat (Felis catus) WB, ELISA MO08420W 100 µg
MO-AB-17436W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17436W 100 µg
MO-AB-24379H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24379C 100 µg
MO-AB-29250W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29250W 100 µg
MO-AB-41316W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41316W 100 µg
MO-AB-51879W Monoclonal Marmoset WB, ELISA MO51879W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus)
CloneMO36985FYA
SpecificityThis antibody binds to Rhesus BIRC5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus BIRC5 Antibody is a mouse antibody against BIRC5. It can be used for BIRC5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBIRC5
UniProt IDF6Q7Y0
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIRPYYSYNWLSFWTLGGHVFIITQEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRCAIEQLAATD.
For Research Use Only | Not For Clinical Use.
Online Inquiry