Mouse Anti-BMF Antibody (MO-AB-08333W)
Cat: MO-AB-08333W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-08333W | Monoclonal | Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO08333W | 100 µg | ||
| CBMOAB-37010FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO37010FYA | 100 µg | ||
| MO-AB-16580W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16580W | 100 µg | ||
| MO-AB-51891W | Monoclonal | Marmoset | WB, ELISA | MO51891W | 100 µg | ||
| MO-AB-08117R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08117R | 100 µg | ||
| MO-AB-24137R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24137R | 100 µg | ||
| MO-AB-01882H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01882C | 100 µg | ||
| MO-AB-24394H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24394C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO08333W |
| Specificity | This antibody binds to Cat BMF. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI) |
| Product Overview | Mouse Anti-Cat BMF Antibody is a mouse antibody against BMF. It can be used for BMF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BMF |
| UniProt ID | Q005V4 |
| Protein Refseq | The length of the protein is 184 amino acids long. The sequence is show below: MEPPQCVEELEDDVFQPDDVEPGTHPGSLLSANLFAQSQLDCPHSHLPLFPLTHCCGPGLRPPIQEYMATQTLSAASQSQGVKLPCGVTQKPQRLFHGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR. |
See other products for " BMF "
| MO-AB-00869Y | Mouse Anti-BMF Antibody (MO-AB-00869Y) |
| MO-AB-36774W | Mouse Anti-BMF Antibody (MO-AB-36774W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry