Mouse Anti-BMP5 Antibody (CBMOAB-37015FYA)


Cat: CBMOAB-37015FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37015FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO37015FYA 100 µg
CBMOAB-67782FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67782FYA 100 µg
MO-AB-00878Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00878Y 100 µg
MO-AB-24160R Monoclonal Pig (Sus scrofa) WB, ELISA MO24160R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO37015FYA
SpecificityThis antibody binds to Rhesus BMP5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed.
Product OverviewMouse Anti-Rhesus BMP5 Antibody is a mouse antibody against BMP5. It can be used for BMP5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBMP5
UniProt IDF7H4M7
Protein RefseqThe length of the protein is 454 amino acids long.
The sequence is show below: MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH.
For Research Use Only | Not For Clinical Use.
Online Inquiry