Mouse Anti-bmt2 Antibody (MO-AB-01898H)


Cat: MO-AB-01898H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01898H Monoclonal Frog (Xenopus laevis), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast WB, ELISA MO01898C 100 µg
CBMOAB-00501CR Monoclonal Yeast WB, ELISA MO00501CR 100 µg
MO-AB-08325W Monoclonal Cat (Felis catus) WB, ELISA MO08325W 100 µg
MO-AB-16489W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16489W 100 µg
MO-AB-29261W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29261W 100 µg
MO-AB-34461W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34461W 100 µg
MO-AB-41318W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41318W 100 µg
MO-AB-08151R Monoclonal Cattle (Bos taurus) WB, ELISA MO08151R 100 µg
MO-AB-00160L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00160L 100 µg
MO-AB-07361Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07361Y 100 µg
MO-AB-10747Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10747Y 100 µg
MO-AB-14399Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14399Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast
CloneMO01898C
SpecificityThis antibody binds to Frog bmt2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionS-adenosyl-L-methionine-binding protein that acts as an inhibitor of mTORC1 signaling via interaction with the GATOR1 and KICSTOR complexes. Acts as a sensor of S-adenosyl-L-methionine to signal methionine sufficiency to mTORC1: in presence of methionine, binds S-adenosyl-L-methionine, leading to disrupt interaction with the GATOR1 and KICSTOR complexes and promote mTORC1 signaling. Upon methionine starvation, S-adenosyl-L-methionine levels are reduced, thereby promoting the association with GATOR1 and KICSTOR, leading to inhibit mTORC1 signaling. Probably also acts as a S-adenosyl-L-methionine-dependent methyltransferase. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against bmt2. It can be used for bmt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable methyltransferase BTM2 homolog; EC 2.1.1.-; LOC443678
UniProt IDQ52KX5
Protein RefseqThe length of the protein is 397 amino acids long.
The sequence is show below: MEPVLPARGNRENVLGKATAEMYVSSFPSEQKTEQEKLSGVVKRVHRDLRKKYREAGDFEKIWLEHCKDKGRLCEYAVAMKALADNHWAKKCEGEGRIEWCLGVCQEYFFNGGKKKAIEKDARRTALNKLQSSNCAEAEVSDFSVPNPKSLNDEYMIGKIRLLDVGSCYNPFLKYEDFLAVGIDIVPAVETVFKCDFLNLQIQRPLQLAPDAIDAFLKQLQSPIDYLPAELFHVVVFSLLLSYFPSPYQRWICCKKAHELLTFNGLLLIITPDSSHQNRHAVIMKSWKIAIESLGFRRMTYSKFSHMHLMAFRKTSLKTTSDLITRNYPDMLYIPQDLNYDREEDHFSNCCLRSELEDEQLACGFTELPDTPYDSDSGDSHNSTMPFYEFEDPILIG.
See other products for " BMT2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry