Mouse Anti-bmt2 Antibody (MO-AB-01898H)
Cat: MO-AB-01898H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-01898H | Monoclonal | Frog (Xenopus laevis), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast | WB, ELISA | MO01898C | 100 µg | ||
CBMOAB-00501CR | Monoclonal | Yeast | WB, ELISA | MO00501CR | 100 µg | ||
MO-AB-08325W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08325W | 100 µg | ||
MO-AB-16489W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16489W | 100 µg | ||
MO-AB-29261W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29261W | 100 µg | ||
MO-AB-34461W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34461W | 100 µg | ||
MO-AB-41318W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41318W | 100 µg | ||
MO-AB-08151R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08151R | 100 µg | ||
MO-AB-00160L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00160L | 100 µg | ||
MO-AB-07361Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07361Y | 100 µg | ||
MO-AB-10747Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10747Y | 100 µg | ||
MO-AB-14399Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14399Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Frog (Xenopus laevis), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast |
Clone | MO01898C |
Specificity | This antibody binds to Frog bmt2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | S-adenosyl-L-methionine-binding protein that acts as an inhibitor of mTORC1 signaling via interaction with the GATOR1 and KICSTOR complexes. Acts as a sensor of S-adenosyl-L-methionine to signal methionine sufficiency to mTORC1: in presence of methionine, binds S-adenosyl-L-methionine, leading to disrupt interaction with the GATOR1 and KICSTOR complexes and promote mTORC1 signaling. Upon methionine starvation, S-adenosyl-L-methionine levels are reduced, thereby promoting the association with GATOR1 and KICSTOR, leading to inhibit mTORC1 signaling. Probably also acts as a S-adenosyl-L-methionine-dependent methyltransferase. (From uniprot, under CC BY 4.0) |
Product Overview | This product is a mouse antibody against bmt2. It can be used for bmt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Probable methyltransferase BTM2 homolog; EC 2.1.1.-; LOC443678 |
UniProt ID | Q52KX5 |
Protein Refseq | The length of the protein is 397 amino acids long. The sequence is show below: MEPVLPARGNRENVLGKATAEMYVSSFPSEQKTEQEKLSGVVKRVHRDLRKKYREAGDFEKIWLEHCKDKGRLCEYAVAMKALADNHWAKKCEGEGRIEWCLGVCQEYFFNGGKKKAIEKDARRTALNKLQSSNCAEAEVSDFSVPNPKSLNDEYMIGKIRLLDVGSCYNPFLKYEDFLAVGIDIVPAVETVFKCDFLNLQIQRPLQLAPDAIDAFLKQLQSPIDYLPAELFHVVVFSLLLSYFPSPYQRWICCKKAHELLTFNGLLLIITPDSSHQNRHAVIMKSWKIAIESLGFRRMTYSKFSHMHLMAFRKTSLKTTSDLITRNYPDMLYIPQDLNYDREEDHFSNCCLRSELEDEQLACGFTELPDTPYDSDSGDSHNSTMPFYEFEDPILIG. |
See other products for " BMT2 "
MO-AB-38454W | Mouse Anti-BMT2 Antibody (MO-AB-38454W) |
CBMOAB-60898FYC | Mouse Anti-bmt2 Antibody (CBMOAB-60898FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry