AibGenesis™ Mouse Anti-borcs7 Antibody (CBMOAB-60899FYC)


Cat: CBMOAB-60899FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60899FYC Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO60899FYC 100 µg
MO-AB-20465W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20465W 100 µg
MO-AB-24411H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24411C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO60899FYC
SpecificityThis antibody binds to Zebrafish borcs7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish borcs7 Antibody is a mouse antibody against borcs7. It can be used for borcs7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUPF0693 protein C10orf32 homolog; borcs7
UniProt IDQ4V8S9
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: MASSETQPRFGQSVKGLLSDKVTSCSGDVIALTRQVLKGSRSQELLSQAARNMVIQEDAILHSEDSLRKMSIITTHLQYQQEAIQKNVEHSKNLQDQLRHLMK.
For Research Use Only | Not For Clinical Use.
Online Inquiry