Mouse Anti-bri3 Antibody (CBMOAB-67946FYA)


Cat: CBMOAB-67946FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67946FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO67946FYA 100 µg
MO-AB-09134R Monoclonal Cattle (Bos taurus) WB, ELISA MO09134R 100 µg
MO-AB-14908W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14908W 100 µg
MO-AB-24419H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24419C 100 µg
MO-AB-51952W Monoclonal Marmoset WB, ELISA MO51952W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO67946FYA
SpecificityThis antibody binds to Zebrafish bri3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionParticipates in tumor necrosis factor-alpha (TNF)-induced cell death (PubMed:14592447). May be a target of Wnt/beta-catenin signaling in the liver (PubMed:20538055). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish bri3 Antibody is a mouse antibody against bri3. It can be used for bri3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbri3; Brain Protein I3
UniProt IDE7FAC9
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MDTKPLLQDRPPAYNTVPSAYDYGSIPAAGAPAAGFQPPAPPPYQGFPAAASGYPAAPAPAAAQPAFSTYTIVQPSVVVVGGCPACRVGVLEDDFTCLGIMCAIFFFPLGILFCLALRQRRCPNCGATFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry