AibGenesis™ Mouse Anti-bsk146 Antibody (CBMOAB-67996FYA)


Cat: CBMOAB-67996FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67996FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO67996FYA 100 µg
MO-AB-01939H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01939C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO67996FYA
SpecificityThis antibody binds to Zebrafish bsk146.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish bsk146 Antibody is a mouse antibody against bsk146. It can be used for bsk146 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine/threonine-protein kinase SBK1; EC 2.7.11.1; SH3-binding kinase 1; bsk14
UniProt IDE7FA06
Protein RefseqThe length of the protein is 385 amino acids long.
The sequence is show below: MSSSPVVSRDILEELQLYTAQNLEKLEVSKYYEVIRELGKGTYGKVDLVIHKIRGSKMALKFLKKKSTKLKSFLREYSISLYLSPCPFIINMFGIAFETDEYYVFAQEYAPSGDLFDIIPPQVGLSEPVAKRCVHQVAIALEYLHSKKLVHRDIKPENILIFDKECRKVKLSDFGMTRRAGSPVKRVSGTIPYTAPELCDTSKHDGFCVDYSTDVWAFGVLLFCMLTGNFPWEKAMPSDTFYEEFVRWQKRRTGAVPSQWRRFTDESLRMFRKLLALEQERRCSVKEVFAHLGHRWMLDGTSGNHHQSVLNSSSEEDELLVDRMKQQTLSPTANTSNAIEPGSANHFTSVSTNSSVSSTNSYERSARDSPPTSRILVTTPIEICV.
For Research Use Only | Not For Clinical Use.
Online Inquiry