Mouse Anti-BSN Antibody (MO-AB-29290W)


Cat: MO-AB-29290W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-29290W Monoclonal Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) WB, ELISA MO29290W 100 µg
CBMOAB-37136FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO37136FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris), Rhesus (Macaca mulatta)
CloneMO29290W
SpecificityThis antibody binds to Dog BSN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Dog BSN Antibody is a mouse antibody against BSN. It can be used for BSN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBrain-specific synapse associated protein, Bassoon; BSN
UniProt IDQ9TSZ5
Protein RefseqThe length of the protein is 74 amino acids long.
The sequence is show below: MGNEASLEGGAGDGPLPPGGTGPGPGPGAGKPPSAPAGGGQLPAVGAARATAGPPGPGPGPGPSPGPGPGPGPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry