AibGenesis™ Mouse Anti-BTBD7 Antibody (CBMOAB-37157FYA)


Cat: CBMOAB-37157FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37157FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO37157FYA 100 µg
CBMOAB-68038FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68038FYA 100 µg
MO-AB-03431W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03431W 100 µg
MO-AB-17426W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17426W 100 µg
MO-AB-51988W Monoclonal Marmoset WB, ELISA MO51988W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO37157FYA
SpecificityThis antibody binds to Rhesus BTBD7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActs as a mediator of epithelial dynamics and organ branching by promoting cleft progression. Induced following accumulation of fibronectin in forming clefts, leading to local expression of the cell-scattering SNAIL2 and suppression of E-cadherin levels, thereby altering cell morphology and reducing cell-cell adhesion. This stimulates cell separation at the base of forming clefts by local, dynamic intercellular gap formation and promotes cleft progression. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus BTBD7 Antibody is a mouse antibody against BTBD7. It can be used for BTBD7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBTBD7
UniProt IDF6XG42
Protein RefseqThe length of the protein is 527 amino acids long.
The sequence is show below: EPNLLSGTAHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPISSEVLSDAMKRGLISTPPSDMLPTTEGGKSNAWLRQKNAGIYVRPRLFSPYVEEAKSVLDEMMVEQTDLVRLRMVRMSNVPDTLYMVNNAVPQCCHMISHQQISSNQSSPPSVVANEIPVPRLLIMKDMVRRLQELRHTEQVQRAYALNCGEGATVSYEIQIRVLREFGLADAAAELLQNPHKFFPDERFGDESPLLTMRQPGRCRVNSTPPAETMFTDLDSFVAFHPPLPPPPPPYHPPATPIHNQLKAGWKQRPPSQHPSRSFSYPCNHSLFHSRTAPKAGPPPVYLPSVKAAPPDCTSTAGLGRQTVAAAAATTTSTATAAAAAAAGAASEKQVRTQPVLNDLMPDIAVGVSTLSLKDRRLPELAVDTELSQSVSEAGPGPPQHLSCISQRHTHTSRKKHTLEQKTDSRENPQEYPDFYDFSNAACRPSTPAPSRRTPSPSQGGYFGPDLYSHNKASPSGLKSAYLPGQTSPKKQEEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry