AibGenesis™ Mouse Anti-BTF3L4 Antibody (CBMOAB-37165FYA)


Cat: CBMOAB-37165FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37165FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO37165FYA 100 µg
CBMOAB-68049FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68049FYA 100 µg
MO-AB-00919Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00919Y 100 µg
MO-AB-09177R Monoclonal Cattle (Bos taurus) WB, ELISA MO09177R 100 µg
MO-AB-21040W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21040W 100 µg
MO-AB-24434H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24434C 100 µg
MO-AB-43872W Monoclonal Horse (Equus caballus) WB, ELISA MO43872W 100 µg
MO-AB-51992W Monoclonal Marmoset WB, ELISA MO51992W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO37165FYA
SpecificityThis antibody binds to Rhesus BTF3L4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BTF3L4 Antibody is a mouse antibody against BTF3L4. It can be used for BTF3L4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBTF3L4
UniProt IDF6Q5X6
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: PRAVVGGPSLLQGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry