AibGenesis™ Mouse Anti-BTG2 Antibody (CBMOAB-37166FYA)


Cat: CBMOAB-37166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37166FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO37166FYA 100 µg
CBMOAB-68051FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68051FYA 100 µg
MO-AB-01950H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01950C 100 µg
MO-AB-14407Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14407Y 100 µg
MO-AB-23915W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23915W 100 µg
MO-AB-24197R Monoclonal Pig (Sus scrofa) WB, ELISA MO24197R 100 µg
MO-AB-24436H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24436C 100 µg
MO-AB-36812W Monoclonal Goat (Capra hircus) WB, ELISA MO36812W 100 µg
MO-AB-51995W Monoclonal Marmoset WB, ELISA MO51995W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO37166FYA
SpecificityThis antibody binds to Rhesus BTG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. (From NCBI)
Product OverviewMouse Anti-Rhesus BTG2 Antibody is a mouse antibody against BTG2. It can be used for BTG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein BTG2; BTG2
UniProt IDH9FC41
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: SLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVAASCGLLTCKNQVLLGRSSPSKNYVMAVSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry