Mouse Anti-BUB3 Antibody (CBMOAB-00552CR)
Cat: CBMOAB-00552CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00552CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO00552CR | 100 µg | ||
CBMOAB-01011HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO01011HB | 100 µg | ||
CBMOAB-02785FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02785FYA | 100 µg | ||
CBMOAB-68113FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO68113FYA | 100 µg | ||
MO-AB-09208R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09208R | 100 µg | ||
MO-AB-25370W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25370W | 100 µg | ||
MO-AB-52004W | Monoclonal | Marmoset | WB, ELISA | MO52004W | 100 µg | ||
MO-DKB-00847W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) | WB, IHC, IHC-P, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio) |
Clone | MO00552CR |
Specificity | This antibody binds to Yeast BUB3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (From NCBI) |
Product Overview | Mouse Anti-Yeast BUB3 Antibody is a mouse antibody against BUB3. It can be used for BUB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cell cycle arrest protein BUB3; BUB3; YOR026W |
UniProt ID | P26449 |
Protein Refseq | The length of the protein is 341 amino acids long. The sequence is show below: MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry