AibGenesis™ Mouse Anti-BZR1 Antibody (CBMOAB-21994FYB)


Cat: CBMOAB-21994FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-21994FYB Monoclonal WB, ELISA MO21994FYB 100 µg
MO-DKB-03787W Polyclonal Rice (Oryza sativa) WB 100 µg
MO-DKB-0572RA Polyclonal WB 50 µL
MOFAB-622W Monoclonal Rice subsp. japonica WB, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Rice (Oryza sativa), Rice (Oryza); A. thaliana (Arabidopsis thaliana), Rice subsp. japonica
CloneMO21994FYB
SpecificityThis antibody binds to Rice BZR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice BZR1 Antibody is a mouse antibody against BZR1. It can be used for BZR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein BZR1 homolog 1; OsBZR1; Protein BRASSINAZOLE-RESISTANT 1 homolog 1; BZR1; Os07g0580500 LOC_Os07g39220
UniProt IDQ7XI96
Protein RefseqThe length of the protein is 298 amino acids long.
The sequence is show below: MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry