Mouse Anti-BZW1 Antibody (CBMOAB-37192FYA)


Cat: CBMOAB-37192FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37192FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO37192FYA 100 µg
MO-AB-01350W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01350W 100 µg
MO-AB-09219R Monoclonal Cattle (Bos taurus) WB, ELISA MO09219R 100 µg
MO-AB-24207R Monoclonal Pig (Sus scrofa) WB, ELISA MO24207R 100 µg
MO-AB-26698W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26698W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO37192FYA
SpecificityThis antibody binds to Rhesus BZW1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BZW1 Antibody is a mouse antibody against BZW1. It can be used for BZW1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBZW1
UniProt IDF6ZFX8
Protein RefseqThe length of the protein is 64 amino acids long.
The sequence is show below: MKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESETEEGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry