Mouse Anti-BZW1 Antibody (CBMOAB-37192FYA)
Cat: CBMOAB-37192FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-37192FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) | WB, ELISA | MO37192FYA | 100 µg | ||
MO-AB-01350W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01350W | 100 µg | ||
MO-AB-09219R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09219R | 100 µg | ||
MO-AB-24207R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24207R | 100 µg | ||
MO-AB-26698W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26698W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) |
Clone | MO37192FYA |
Specificity | This antibody binds to Rhesus BZW1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus BZW1 Antibody is a mouse antibody against BZW1. It can be used for BZW1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BZW1 |
UniProt ID | F6ZFX8 |
Protein Refseq | The length of the protein is 64 amino acids long. The sequence is show below: MKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESETEEGD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry