Mouse Anti-C. elegans ABF1 Antibody (CBMOAB-00184HCB)


Cat: CBMOAB-00184HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00184HB
SpecificityThis antibody binds to C. elegans ABF1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans ABF1 (clone MO00184HB) Antibody (CBMOAB-00184HCB) is a mouse antibody against ABF1. It can be used for ABF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAntibacterial factor-related peptide 1; abf-1
Gene ID266827
UniProt IDG5EGC4
Protein RefseqThe length of the protein is 85 amino acids long. The sequence is show below: MLYFCLLLVLLLPNNGVSSEASCARMDVPVMQRIAQGLCTSSCTAQKCMTGICKKVDSHPTCFCGGCSNANDVSLDTLISQLPHN.

See other products for " ABF1 "

CBMOAB-1371FYCMouse Anti-Arabidopsis ABF1 Antibody (CBMOAB-1371FYC)
CBMOAB-00092CRMouse Anti-Yeast ABF1 Antibody (CBMOAB-00092CR)
CBMOAB-1370FYCMouse Anti-Arabidopsis ABF1 Antibody (CBMOAB-1370FYC)
CBMOAB-00185HCBMouse Anti-C. elegans ABF1 Antibody (CBMOAB-00185HCB)
MO-AB-00007HMouse Anti-Arabidopsis ABF1 Antibody (MO-AB-00007H)
For Research Use Only | Not For Clinical Use.

Online Inquiry