Mouse Anti-C. elegans ABF1 Antibody (CBMOAB-00184HCB)
Cat: CBMOAB-00184HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO00184HB |
Specificity | This antibody binds to C. elegans ABF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | General regulatory factor (GRF) that contributes to transcriptional activation of a large number of genes, as well as to DNA replication, silencing and telomere structure. Involved in the transcription activation of a subset of ribosomal protein genes. Binds the ARS-elements found in many promoters. Binds to the sequence 5''-TCNACG-3''. Influences on genome-wide nucleosome occupancy and affects chromatin structure, and probably dynamics. As a component of the global genome repair (GGR) complex, promotes global genome nucleotide excision repair (GG-NER) which removes DNA damage from nontranscribing DNA. Component of the regulatory network controlling mitotic and meiotic cell cycle progression. |
Product Overview | Mouse Anti-C. elegans ABF1 Antibody is a mouse antibody against ABF1. It can be used for ABF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Antibacterial factor-related peptide 1; abf-1 |
Gene ID | 266827 |
UniProt ID | G5EGC4 |
Protein Refseq | The length of the protein is 85 amino acids long. The sequence is show below: MLYFCLLLVLLLPNNGVSSEASCARMDVPVMQRIAQGLCTSSCTAQKCMTGICKKVDSHPTCFCGGCSNANDVSLDTLISQLPHN. |
See other products for " ABF1 "
CBMOAB-00092CR | Mouse Anti-Yeast ABF1 Antibody (CBMOAB-00092CR) |
MO-AB-00007H | Mouse Anti-Arabidopsis ABF1 Antibody (MO-AB-00007H) |
CBMOAB-1370FYC | Mouse Anti-Arabidopsis ABF1 Antibody (CBMOAB-1370FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry