Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans COL10 Antibody (CBMOAB-00013HCB)


Cat: CBMOAB-00013HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00013HB
SpecificityThis antibody binds to C. elegans COL10.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNematode cuticles are composed largely of collagen-like proteins. The cuticle functions both as an exoskeleton and as a barrier to protect the worm from its environment (By similarity).
Product OverviewMouse Anti-C. elegans COL10 (clone MO00013HB) Antibody (CBMOAB-00013HCB) is a mouse antibody against COL10. It can be used for COL10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCuticle collagen 10; col-10
Gene ID179298
UniProt IDQ17460
Protein RefseqThe length of the protein is 294 amino acids long. The sequence is show below: MEKFLVTLSTGAASIAVLAVLFTVPSLYNTINEVHDEVLDGVSVFRVETDSAWTEMMDIQITVTPPTKPRVNPFNSIFRQKRQTFSGLPAWCQCEPTKPTCPPGPPGPPGQPGAPGTPGAPGPKGDDNTATFAPLTCAPVSQDCVKCPEGPAGPAGPEGPAGPAGPDGQPGAPGNAGNPGSDGQPGAPGDNGQDGAPGQDGQPGAPGQDGQRGSGAPGGPGAPGNAGPAGPAGQDGAPGQDGQPGPAGPAGQDGAPGNAGSDGQPGAPGGPGLPGNDAAYCACPPRSAVFVSRH.
For Research Use Only | Not For Clinical Use.

Online Inquiry