Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans COL2 Antibody (CBMOAB-00016HCB)


Cat: CBMOAB-00016HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00016HB
SpecificityThis antibody binds to C. elegans COL2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNematode cuticles are composed largely of collagen-like proteins. The cuticle functions both as an exoskeleton and as a barrier to protect the worm from its environment.
Product OverviewMouse Anti-C. elegans COL2 (clone MO00016HB) Antibody (CBMOAB-00016HCB) is a mouse antibody against COL2. It can be used for COL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCuticle collagen 2; col-2
Gene ID177872
UniProt IDP17656
Protein RefseqThe length of the protein is 301 amino acids long. The sequence is show below: MDIDARIKAYKFVAYSAVTFSVVAVVSVFITLPMVYNYVNNVKKQIHTDVNFCKVSARDIWSEVHLIKDAPGNNTRVARQAYSTGGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKGASAPCEPVTQPPCQPCPGGPPGPAGPAGPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGPGPAGPKGPPGAAGAPGADGNPGGPGTAGKPGGEGEKGICPKYCAIDGGVFFEDGTRRR.
For Research Use Only | Not For Clinical Use.

Online Inquiry