Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans CPR3 Antibody (CBMOAB-00022HCB)


Cat: CBMOAB-00022HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00022HB
SpecificityThis antibody binds to C. elegans CPR3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-C. elegans CPR3 (clone MO00022HB) Antibody (CBMOAB-00022HCB) is a mouse antibody against CPR3. It can be used for CPR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin B-like cysteine proteinase 3; cpr-3
Gene ID180033
UniProt IDP43507
Protein RefseqThe length of the protein is 370 amino acids long. The sequence is show below: MLKVYFLALFLAGCSAFVLDEIRGINIGQSPQKVLVDHVNTVQTSWVAEHNEISEFEMKFKVMDVKFAEPLEKDSDVASELFVRGEIVPEPLPDTFDAREKWPDCNTIKLIRNQATCGSCWAFGAAEVISDRVCIQSNGTQQPVISVEDILSCCGTTCGYGCKGGYSIEALRFWASSGAVTGGDYGGHGCMPYSFAPCTKNCPESTTPSCKTTCQSSYKTEEYKKDKHYGASAYKVTTTKSVTEIQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIANSWGTSFGEKGFFKIRRGTNECQIEGNVVAGIAKLGTHSETYEDDGGAATSCSFIMCTLMVLTYYFV.

See other products for " CPR3 "

For Research Use Only | Not For Clinical Use.

Online Inquiry