AibGenesis™ Mouse Anti-C10orf11 Antibody (CBMOAB-37201FYA)


Cat: CBMOAB-37201FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37201FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO37201FYA 100 µg
CBMOAB-68233FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68233FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO37201FYA
SpecificityThis antibody binds to Rhesus C10orf11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C10orf11 Antibody is a mouse antibody against C10orf11. It can be used for C10orf11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat-containing protein C10orf11; C10orf11
UniProt IDH9FD55
Protein RefseqThe length of the protein is 73 amino acids long.
The sequence is show below: PNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGAFMKVVKPKASSEDVAGSPELHYMP.
For Research Use Only | Not For Clinical Use.
Online Inquiry