AibGenesis™ Mouse Anti-C16orf59 Antibody (CBMOAB-37389FYA)


Cat: CBMOAB-37389FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37389FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37389FYA 100 µg
MO-AB-20034W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20034W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37389FYA
SpecificityThis antibody binds to Rhesus C16orf59.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C16orf59 Antibody is a mouse antibody against C16orf59. It can be used for C16orf59 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC16orf59
UniProt IDF7AW42
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: MLPADCSRRLVAELQGALDACAHRQLQLEQSLRVCRRLLQAWEPTGTWAWEPPPEPETNEEDPLPACTPSPQDLKELEFLTQALEKAVRVRRGITKAGERNKAPSLKPRSIVTSPGTTASTPPQSPGQAGGHASDRRPTKGLRQTTVPAKGRPERRLPSVRDRTRAGIGARAPRPGAGLRNQHMAPSAAPQAPEAFTLKEKGHLLRLPAAFRKAASQNSSLWAQLSSMQTSDSMDAAAAKTQFLRNIQTASGGSQPRLSAAEVEAEARRLRKACSLLRLRVREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLQRLQELRAAPRSCRPWRPSSCEWPCWTSRSTWKRCFWKRRWGCNRGLQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry