Mouse Anti-C17orf39 Antibody (CBMOAB-37418FYA)


Cat: CBMOAB-37418FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37418FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37418FYA 100 µg
MO-AB-14475W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14475W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37418FYA
SpecificityThis antibody binds to Rhesus C17orf39.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C17orf39 Antibody is a mouse antibody against C17orf39. It can be used for C17orf39 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein C17orf39; C17orf39
UniProt IDH9F8I1
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MPVRTECPPTAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR.
For Research Use Only | Not For Clinical Use.
Online Inquiry