Mouse Anti-C19orf25 Antibody (CBMOAB-37468FYA)


Cat: CBMOAB-37468FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37468FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37468FYA 100 µg
MO-AB-18347W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18347W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37468FYA
SpecificityThis antibody binds to Rhesus C19orf25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC19orf25 (Chromosome 19 Open Reading Frame 25) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus C19orf25 Antibody is a mouse antibody against C19orf25. It can be used for C19orf25 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC19orf25
UniProt IDF6VEP0
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MGSKTKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTTLAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGDALRQRLPPQADLSGSAGLGSARGGLRPGFPGPLAPDAFMGSQPGWVTQAPLLTLGLRFIRRPIHAKLVGPTQLALSCVT.
For Research Use Only | Not For Clinical Use.
Online Inquiry