AibGenesis™ Mouse Anti-C21orf63 Antibody (CBMOAB-37636FYA)


Cat: CBMOAB-37636FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37636FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO37636FYA 100 µg
MO-AB-19960W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19960W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO37636FYA
SpecificityThis antibody binds to Rhesus C21orf63.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C21orf63 Antibody is a mouse antibody against C21orf63. It can be used for C21orf63 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein C21orf63; C21orf63
UniProt IDH9F4C0
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: LKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQEKDICSSEAERLPPFDCLSYSASQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLKQKDGEYGINFDPSESKVLRKDGILVSNSLAAFAYIRAHPERAALLFVSSVGIGLALTLCALVIRESCAKDFRKLQLGREQLVPGSDKAEEDSEDEEEEEDSSESDFPGELSGFCRTSYPVYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry