Mouse Anti-CABP5 Antibody (CBMOAB-37971FYA)


Cat: CBMOAB-37971FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37971FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO37971FYA 100 µg
MO-AB-09371R Monoclonal Cattle (Bos taurus) WB, ELISA MO09371R 100 µg
MO-AB-24465H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24465C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO37971FYA
SpecificityThis antibody binds to Rhesus CABP5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown.
Product OverviewMouse Anti-Rhesus CABP5 Antibody is a mouse antibody against CABP5. It can be used for CABP5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcium-binding protein 5; CABP5
UniProt IDH9FHZ4
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: GNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLAELQQAMQRLLGERLTPREISEVVREADVNGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry