AibGenesis™ Mouse Anti-CAMK2N2 Antibody (CBMOAB-38074FYA)
Cat: CBMOAB-38074FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38074FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO38074FYA | 100 µg | ||
| CBMOAB-68903FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO68903FYA | 100 µg | ||
| MO-AB-09456R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09456R | 100 µg | ||
| MO-AB-23523W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23523W | 100 µg | ||
| MO-AB-24499H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24499C | 100 µg | ||
| MO-AB-52173W | Monoclonal | Marmoset | WB, ELISA | MO52173W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO38074FYA |
| Specificity | This antibody binds to Rhesus CAMK2N2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Cytoskeleton |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus CAMK2N2 Antibody is a mouse antibody against CAMK2N2. It can be used for CAMK2N2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Calcium/calmodulin-dependent protein kinase II inhibitor 2; CAMK2N2 |
| UniProt ID | H9EN80 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry