AibGenesis™ Mouse Anti-CAMKMT Antibody (CBMOAB-38081FYA)


Cat: CBMOAB-38081FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38081FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38081FYA 100 µg
CBMOAB-68909FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68909FYA 100 µg
MO-AB-09458R Monoclonal Cattle (Bos taurus) WB, ELISA MO09458R 100 µg
MO-AB-16841W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16841W 100 µg
MO-AB-52180W Monoclonal Marmoset WB, ELISA MO52180W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO38081FYA
SpecificityThis antibody binds to Rhesus CAMKMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CAMKMT Antibody is a mouse antibody against CAMKMT. It can be used for CAMKMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCAMKMT
UniProt IDF7HIR5
Protein RefseqThe length of the protein is 323 amino acids long.
The sequence is show below: MESRVADAGAGETARAAGGRPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHVSVRRFESFNLFSVTEVKERETEKEVGAWVQYTSIFCPEYSISIRHNSGSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLKHSNIFRALAVCELGGGMTCLAGLMVAISANVKKFLLTDGNEKAIKNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFSIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLLLTKHG.
For Research Use Only | Not For Clinical Use.
Online Inquiry