Mouse Anti-Cart Antibody (MO-AB-24507H)


Cat: MO-AB-24507H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24507H Monoclonal Rat (Rattus norvegicus), Chicken (Gallus gallus), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa) WB, ELISA MO24507C 100 µg
MO-AB-02325W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02325W 100 µg
MO-AB-24304R Monoclonal Pig (Sus scrofa) WB, ELISA MO24304R 100 µg
MO-AB-00974Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00974Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Chicken (Gallus gallus), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa)
CloneMO24507C
SpecificityThis antibody binds to Rat Cart.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Cart. It can be used for Cart detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCocaine-amphetamine regulated transcript; Cartpt; Cart
UniProt IDQ8K3Z3
Protein RefseqThe length of the protein is 94 amino acids long.
The sequence is show below: MESSRLRLLPVLGAALLLLLPLLGAGAQEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKSKRIPIYEKKYGQVPM.
For Research Use Only | Not For Clinical Use.
Online Inquiry