Mouse Anti-CASP2 Antibody (CBMOAB-25709FYC)
Cat: CBMOAB-25709FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-25709FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO25709FC | 100 µg | ||
CBMOAB-38176FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38176FYA | 100 µg | ||
CBMOAB-69073FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69073FYA | 100 µg | ||
MO-AB-07809W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07809W | 100 µg | ||
MO-AB-10927W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10927W | 100 µg | ||
MO-AB-29334W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29334W | 100 µg | ||
MO-AB-34480W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34480W | 100 µg | ||
MO-AB-41343W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41343W | 100 µg | ||
MO-AB-52284W | Monoclonal | Marmoset | WB, ELISA | MO52284W | 100 µg | ||
MO-AB-09512R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09512R | 100 µg | ||
MO-AB-02076H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02076C | 100 µg | ||
MO-AB-32893H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32893C | 100 µg | ||
MO-AB-00171L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00171L | 100 µg | ||
MO-AB-00982Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00982Y | 100 µg | ||
MO-AB-07439Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07439Y | 100 µg | ||
MO-AB-10793Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10793Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO25709FC |
Specificity | This antibody binds to Arabidopsis CASP2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Cell Wall; Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Product Overview | Mouse Anti-Arabidopsis CASP2 Antibody is a mouse antibody against CASP2. It can be used for CASP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caspase 2; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 2; Protein Phosphatase 1, Regulatory Subunit 57; Protease ICH-1; EC 3.4.22.55; CASP-2; NEDD-2; NEDD2 |
UniProt ID | Q9CAX3 |
Protein Refseq | The length of the protein is 204 amino acids long. The sequence is show below: MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAVVSAFVSVVFFTILVVISGVALKRH. |
See other products for " CASP2 "
MO-AB-23008H | Mouse Anti-CASP2 Antibody (MO-AB-23008H) |
MO-AB-06346Y | Mouse Anti-CASP2 Antibody (MO-AB-06346Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry