Mouse Anti-CASP4 Antibody (CBMOAB-25711FYC)
Cat: CBMOAB-25711FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-25711FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA | MO25711FC | 100 µg | ||
CBMOAB-38180FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38180FYA | 100 µg | ||
MO-AB-07441Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07441Y | 100 µg | ||
MO-AB-07848W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07848W | 100 µg | ||
MO-AB-09515R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09515R | 100 µg | ||
MO-AB-11673W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11673W | 100 µg | ||
MO-AB-29336W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29336W | 100 µg | ||
MO-AB-34482W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34482W | 100 µg | ||
MO-AB-43907W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43907W | 100 µg | ||
MO-AB-52286W | Monoclonal | Marmoset | WB, ELISA | MO52286W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) |
Clone | MO25711FC |
Specificity | This antibody binds to Arabidopsis CASP4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Cell Wall; Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Arabidopsis CASP4 Antibody is a mouse antibody against CASP4. It can be used for CASP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caspase 4; Caspase 4, Apoptosis-Related Cysteine Peptidase; Caspase 4, Apoptosis-Related Cysteine Protease; ICE And Ced-3 Homolog 2; Protease TX; ICE(Rel)-II; CASP-4; ICH-2; Mih1; Apoptotic Cysteine Protease Mih1/TX |
UniProt ID | Q9FFZ7 |
Protein Refseq | The length of the protein is 202 amino acids long. The sequence is show below: MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVSAFASVTFLAILVVISGVSLKRP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry