Mouse Anti-CASP4 Antibody (CBMOAB-25711FYC)


Cat: CBMOAB-25711FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25711FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO25711FC 100 µg
CBMOAB-38180FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38180FYA 100 µg
MO-AB-07441Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07441Y 100 µg
MO-AB-07848W Monoclonal Cat (Felis catus) WB, ELISA MO07848W 100 µg
MO-AB-09515R Monoclonal Cattle (Bos taurus) WB, ELISA MO09515R 100 µg
MO-AB-11673W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11673W 100 µg
MO-AB-29336W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29336W 100 µg
MO-AB-34482W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34482W 100 µg
MO-AB-43907W Monoclonal Horse (Equus caballus) WB, ELISA MO43907W 100 µg
MO-AB-52286W Monoclonal Marmoset WB, ELISA MO52286W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO25711FC
SpecificityThis antibody binds to Arabidopsis CASP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cell Wall; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Arabidopsis CASP4 Antibody is a mouse antibody against CASP4. It can be used for CASP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase 4; Caspase 4, Apoptosis-Related Cysteine Peptidase; Caspase 4, Apoptosis-Related Cysteine Protease; ICE And Ced-3 Homolog 2; Protease TX; ICE(Rel)-II; CASP-4; ICH-2; Mih1; Apoptotic Cysteine Protease Mih1/TX
UniProt IDQ9FFZ7
Protein RefseqThe length of the protein is 202 amino acids long. The sequence is show below: MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAVAPRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVSAFASVTFLAILVVISGVSLKRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry