Mouse Anti-Cat CALCA Antibody (MO-AB-08454W)


Cat: MO-AB-08454W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08454W
SpecificityThis antibody binds to Cat CALCA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cat CALCA Antibody is a mouse antibody against CALCA. It can be used for CALCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcitonin; LOC101094539; CALCA
UniProt IDM3WJM0
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: MGFGKSSPFLAFSILVLCQAGSLQAAPFRSALESLPDPTTLSEKEGRLLLAALVKAYVQGKTNELEQEQEQEETEGSSLDSFRAKRCSNLSTCVLGAYSKDLNNFHTFSGIGFGAETPGKKRDIASSLEKGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry