Mouse Anti-Cat CD86 Antibody (MO-AB-08470W)


Cat: MO-AB-08470W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08470W
SpecificityThis antibody binds to Cat CD86.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD86 (CD86 Molecule) is a Protein Coding gene. Diseases associated with CD86 include Gallbladder Squamous Cell Carcinoma and Myocarditis. Among its related pathways are Cytokine Signaling in Immune system and Th2 Differentiation Pathway. Gene Ontology (GO) annotations related to this gene include receptor binding and coreceptor activity. An important paralog of this gene is CD80.
Product OverviewMouse Anti-Cat CD86 Antibody is a mouse antibody against CD86. It can be used for CD86 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB-lymphocyte activation antigen B7-2; CD86; CD86
UniProt IDQ9GMZ7
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MGICDSTMGLSHTLLVMALLLSGVSSMKSQAYFNKTGELPCHFTNSQNISLDELVVFWQDQDKLVLYEIFRGKENPQNVHLKYKGRTSFDKDNWTLRLHNVQIKDKGTYHCFIHYKGPKGLVPMHQMSSDLSVLANFSQPEITVTSNRTENSGIINLTCSSIQGYPEPKEMYFQLNTENSTTKYDTVMKKSQNNVTELYNVSISLPFSVPEAHNVSVFCALKLETLEMLLSLPFNIDAQPKDKDPEQGHFLWIAAVLVMFVVFCGMVSFKTLRKRKKKQPGPSHECETIKRERKESKQTNERVPYHVPERSDEAQCVNILKTASGDKSTTHF.
See other products for " CD86 "
CBMOAB-38743FYAMouse Anti-Rhesus CD86 Antibody (CBMOAB-38743FYA)
CBMOAB-00085FYAMouse Anti-Cattle CD86 Antibody (CBMOAB-00085FYA)
MO-AB-29491WMouse Anti-Dog CD86 Antibody (MO-AB-29491W)
MO-AB-44008WMouse Anti-Horse CD86 Antibody (MO-AB-44008W)
MO-AB-52589WMouse Anti-Marmoset CD86 Antibody (MO-AB-52589W)
MO-AB-24658HMouse Anti-Rat Cd86 Antibody (MO-AB-24658H)
MO-AB-01571WMouse Anti-Rhesus CD86 Antibody (MO-AB-01571W)
MO-AB-01075YMouse Anti-Chicken CD86 Antibody (MO-AB-01075Y)
MO-AB-14514YMouse Anti-Sheep CD86 Antibody (MO-AB-14514Y)
MO-NAB-00354WRabbit Anti-CD86 Antibody (AA 1-40)
For Research Use Only | Not For Clinical Use.
Online Inquiry