Mouse Anti-Cat Chat Antibody (MO-AB-09579W)


Cat: MO-AB-09579W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09579W
SpecificityThis antibody binds to Cat Chat.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
Product OverviewMouse Anti-Cat Chat Antibody is a mouse antibody against Chat. It can be used for Chat detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCholine acetyltransferase; Chat
UniProt IDQ0PS43
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: SQAIVQRFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAANLISGVLSYKTLLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHIQDTLVAQKSSVMPEPEHVIVACCNQFFVLDVVINFRRLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry