Mouse Anti-Cat CMA1 Antibody (MO-AB-09654W)


Cat: MO-AB-09654W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09654W
SpecificityThis antibody binds to Cat CMA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.
Product OverviewMouse Anti-Cat CMA1 Antibody is a mouse antibody against CMA1. It can be used for CMA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCMA1
UniProt IDA0M8Z6
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: VIKQFPHPKYDDCTFLHDIMLLKLKEKANLTLAVGTLPLPPQFNVIPPGRMCRVAGWGRTQVNEPGSDTLREVKQRLMNPQACRHYRTFDHNFQLCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry