AibGenesis™ Mouse Anti-CTLA-4 Antibody (MO-AB-07904W)


Cat: MO-AB-07904W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07904W Monoclonal Cat (Felis catus), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Rat (Rattus norvegicus) WB, ELISA MO07904W 100 µg
MO-AB-23106H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23106C 100 µg
MO-AB-25191H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25191C 100 µg
MO-AB-43039W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43039W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Rat (Rattus norvegicus)
CloneMO07904W
SpecificityThis antibody binds to Cat CTLA-4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat CTLA-4 Antibody is a mouse antibody against CTLA-4. It can be used for CTLA-4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytotoxic T lymphocyte-associated antigen 4; CTLA-4
UniProt IDQ9XSY7
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MAGFGFRRHGAQPDLASRTWPCTALFSLLFIPVFSKGMHVAQPAVVLASSRGVASFVCEYGSSGNAAEVRVTVLRQAGSQMTEVCAVTYTVEDELAFLDDSTCTGTSSGNKVNLTIQGLRAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLITAVSLSKVLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry